Skip to main content

Table 4 Mutations identified in recessive brh1 alleles and their deduced effect at protein level

From: Mutations in the gene of the Gα subunit of the heterotrimeric G protein are the cause for the brachytic1 semi-dwarf phenotype in barley and applicable for practical breeding

Allele Position of mutationa Type of mutation Effect of mutation on protein
BW047 (ari-i.38) 2345 a to t Mutation shifts splice site between intron 8 and exon 9 leading to frame shift. 203 native amino-acid residues followed by FSAAPLERAKEAERYTGCMM.
BW074 (brh1.a) 3745-3746 2 bp deletion Frame shift eliminates wild type stop codon and extends exon 13. 372 native residues followed by 152 additional aa residues.
BW075 (brh1.aa) 2205 1 bp deletion Frame shift in exon 8. 185 native residues followed by MCSMQEYGQMGL.
BW076 (brh1.ae) Deletion (minimal region: −723 to 2819 Large deletion, no transcript detectable Probably no protein produced
brh1.c 3745-3746 2 bp deletion Frame shift eliminates wild type stop codon and extends exon 13. 372 native residues followed by 152 additional residues.
BW077 (brh1.e) 813 g to a Mutation eliminates splice site between intron 4 and exon 5 leading to frameshift. 88 native residues followed by VCYYWKGCVSYLFPHLLHSGDYSGNLHWIFLWECVYTSYY.
brh1.f 1512-1515 4 bp deletion Frame shift and premature stop in exon 6. 129 native residues followed by SLIKNSYRM.
BW078 (brh1.t) 2346 g to a Mutation shifts splice site between intron 8 and exon 9. 203 native residues followed by FSATPLERAKEVERYTGCMM.
BW079 (brh1.x) 3718 a to t Premature stop in exon 13. Truncated protein of 363 residues.
BW080 (brh1.z) 2205 1 bp deletion Frame shift in exon 8. 185 native residues followed by MCSMQEYGQMGL.
ari-m.12 3178 g to a Premature stop in exon 10. Truncated protein of 270 native residues.
BW051 (ari-m.28) 3178 g to a Premature stop in exon 10. Truncated protein of 270 native residues.
ari-m.141 164 g to a Mutation eliminates splice site between intron 1 and exon 2. 21 native residues followed by VSSFPYHLLDSFNSSCPVLSCPVLS.
ari-m.177 2345 a to t Mutation shifts splice site between intron 8 and exon 9 leading to frame shift. 203 native residues followed by FSAAPLERAKEAERYTGCMM.
ari-m.251   Large deletion No protein produced.
ari-m.269 3449 g to a Premature stop in exon 12. Truncated protein of 306 residues.
  1. The deduced polypeptide of Brh1 (AF267485) is 383 amino-acid residues
  2. aFirst position is the “A” of the ATG start codon in the Bowman genomic sequence